PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0046s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 513aa    MW: 56303.6 Da    PI: 4.9939
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0046s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.57e-29185238155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r++W+ eLH++Fv+av+qL G++kA+Pk+il++m+v+gLt+e+v+SHLQkYRl
  Sphfalx0046s0042.1.p 185 KARVVWSVELHKQFVQAVNQL-GIDKAVPKRILDVMNVQGLTRENVASHLQKYRL 238
                           68*******************.********************************8 PP

2Response_reg84.53.1e-28151231109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdDepl +++l ++l++ +y +v+++  +++al ll+e++  +Dl++ D+ mp+mdG++ll+ i  e  +lp+i+++a ge +++ 
  Sphfalx0046s0042.1.p  15 VLVVDDEPLCLMILDRMLRQCKY-NVTSCNRATKALSLLRENRnyFDLVISDVYMPDMDGFKLLEAIGLEL-DLPVIMMSADGETDLVM 101
                           89*********************.***************999999**********************5544.6**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+  eel++
  Sphfalx0046s0042.1.p 102 KGITHGACDYLLKPVRLEELRN 123
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.4E-4211146No hitNo description
SuperFamilySSF521724.13E-3811141IPR011006CheY-like superfamily
SMARTSM004481.3E-3113125IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.97614129IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2515124IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.92E-2916129No hitNo description
PROSITE profilePS5129411.035182241IPR017930Myb domain
SuperFamilySSF466891.08E-19183242IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-29184243IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-25185238IPR006447Myb domain, plants
PfamPF002491.2E-7187237IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MAIPGGGSFP EGMRVLVVDD EPLCLMILDR MLRQCKYNVT SCNRATKALS LLRENRNYFD  60
LVISDVYMPD MDGFKLLEAI GLELDLPVIM MSADGETDLV MKGITHGACD YLLKPVRLEE  120
LRNIWQHVIR RRVPTKDLHR EEGSGEWDDS VYPHDSTTDT DHSFRKRKER VDDEIQRAED  180
LNLKKARVVW SVELHKQFVQ AVNQLGIDKA VPKRILDVMN VQGLTRENVA SHLQKYRLYL  240
KRLSGVNPEP YPVASFQAAE NGTSGGVMQI QPGGRAVVSS GSKGWNLGGG VSRNIAQKDA  300
EARGSLQAQL LQQKQQRQQL AGTLEGLNQL TAGVAFPDLQ RMDSHDLDLL MKPQYDPTRQ  360
RPGLANDHLP ILGNLNVLEN FDLSGLIDLK EGENAVAMSN LGTLSTHNNL NSVAMGTLQR  420
GEDMGSMTNS QPGDSLSGGP GFSRPRGGDD LVPAEGMGLG LSKFGGEFTS ASCFSSVDTL  480
SNEDISESSF KDYQEFAGSP DFLTPPNDLS LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-21184244464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001760366.11e-129predicted protein, partial
TrEMBLA9S2241e-129A9S224_PHYPA; Predicted protein (Fragment)
STRINGPP1S42_161V6.11e-161(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-99response regulator 2